VIP (Vasoactive Intestinal Peptide) is a 28-amino acid neuropeptide belonging to the secretin/glucagon superfamily, naturally distributed throughout the central and peripheral nervous systems and gastrointestinal tissues. It is a frequent subject of laboratory research and is supplied as a lyophilized powder for research use only.
In published in vitro and preclinical research, VIP has been studied in connection with binding to the class II G-protein-coupled receptors VPAC1 and VPAC2 and downstream cAMP/PKA signaling. These studies are conducted in cell-culture and animal research models. The findings derive from laboratory research and do not describe or imply any effect, benefit, or use in humans or animals.
Published literature has examined VIP across a range of cell-culture and animal research models relating to VPAC receptor signaling biology and neuroimmune signaling pathways. These reports reflect controlled laboratory conditions only and do not translate to dosing, treatment, or applications in any other context. Its mechanism is studied alongside related research compounds such as KPV, Thymalin, and Thymosin Alpha-1.
For further reading, see published research on Vasoactive Intestinal Peptide on PubMed.
Product Specifications
| CAS Number | 40077-57-4 |
| Molecular Formula | C₁₄₇H₂₃₈N₄₄O₄₂S |
| Molecular Weight | ~3,326 g/mol |
| Amino Acid Count | 28 |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ |
| Synonyms | Vasoactive Intestinal Polypeptide, VIP |
| Purity | ≥99% by HPLC | COA available |
| Physical Form | Lyophilized powder |
| Storage Conditions | Store at −20°C; protect from light and moisture |
For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures. This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. Not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.










Reviews
There are no reviews yet.